ABH1 Recombinant Protein Antigen

Images

 
There are currently no images for ABH1 Protein (NBP2-14283PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

ABH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALKBH1.

Source: E. coli

Amino Acid Sequence: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALKBH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14283.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABH1 Recombinant Protein Antigen

  • ABH1
  • ABHalkB, alkylation repair homolog (E. coli)
  • alkB
  • alkB, alkylation repair homolog 1 (E. coli)
  • ALKBH
  • alkylated DNA repair protein alkB homolog 1
  • alkylation repair, alkB homolog
  • Alpha-ketoglutarate-dependent dioxygenase ABH1
  • DNA lyase ABH1
  • EC 1.14.11.-
  • EC 4.2.99.18
  • hABH

Background

ABH1 encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-76276
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for ABH1 Protein (NBP2-14283PEP) (0)

There are no publications for ABH1 Protein (NBP2-14283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABH1 Protein (NBP2-14283PEP) (0)

There are no reviews for ABH1 Protein (NBP2-14283PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABH1 Protein (NBP2-14283PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABH1 Products

Bioinformatics Tool for ABH1 Protein (NBP2-14283PEP)

Discover related pathways, diseases and genes to ABH1 Protein (NBP2-14283PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABH1 Protein (NBP2-14283PEP)

Discover more about diseases related to ABH1 Protein (NBP2-14283PEP).
 

Pathways for ABH1 Protein (NBP2-14283PEP)

View related products by pathway.

PTMs for ABH1 Protein (NBP2-14283PEP)

Learn more about PTMs related to ABH1 Protein (NBP2-14283PEP).
 

Research Areas for ABH1 Protein (NBP2-14283PEP)

Find related products by research area.

Blogs on ABH1

There are no specific blogs for ABH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALKBH1