ABCD2 Antibody - Azide and BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of L929 cells using ABCD2 . Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of U-2 OS cells using ABCD2 . Blue: DAPI for nuclear staining.

Product Details

Summary
Product Discontinued
View other related ABCD2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-92633
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCD2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 420-500 of human ABCD2 (NP_005155.1). TARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAGEVVASRLNFK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Western Blot 1:500-1:2000
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for ABCD2 Antibody - Azide and BSA Free

  • Adrenoleukodystrophy-like 1
  • Adrenoleukodystrophy-related protein
  • ALD1
  • ALDL1ATP-binding cassette sub-family D member 2
  • ALDRhALDR
  • ALDRPABC39
  • ATP-binding cassette, sub-family D (ALD), member 2

Background

The protein encoded by the ABCD2 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCproteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into sevendistinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily,which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomalABC transporters are half transporters which require a partner half transporter molecule to form a functionalhomodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however thisprotein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters.Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. Thisgene has been identified as a candidate for a modifier gene, accounting for the extreme variation amongadrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, agenetically heterogeneous disorder of peroxisomal biogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
DMD00
Species: Hu
Applications: ELISA
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-42342
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for ABCD2 Antibody (NBP2-92633) (0)

There are no publications for ABCD2 Antibody (NBP2-92633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCD2 Antibody (NBP2-92633) (0)

There are no reviews for ABCD2 Antibody (NBP2-92633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCD2 Antibody (NBP2-92633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCD2 Products

Array NBP2-92633

Research Areas for ABCD2 Antibody (NBP2-92633)

Find related products by research area.

Blogs on ABCD2

There are no specific blogs for ABCD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCD2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD2