ABCA9 Recombinant Protein Antigen

Images

 
There are currently no images for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCA9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA9.

Source: E.coli

Amino Acid Sequence: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68700. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA9 Recombinant Protein Antigen

  • ATP-binding cassette A9
  • ATP-binding cassette sub-family A member 9
  • ATP-binding cassette, sub-family A (ABC1), member 9
  • DKFZp686F2450
  • EC 3.6.3
  • EC 3.6.3.41
  • EST640918
  • MGC75415

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023460-Q01
Species: Hu
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-91641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59809
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
H00010349-Q01
Species: Hu
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-77687
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00089845-P01
Species: Hu
NB400-163
Species: Mu
Applications: WB, Flow, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, PCR
H00113246-P01
Species: Hu
NBP1-20863
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009781-B02P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-30032
Species: Hu, Mu, Bv, Ca, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP) (0)

There are no publications for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP) (0)

There are no reviews for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ABCA9 Products

Array NBP2-68700PEP

Bioinformatics Tool for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP)

Discover related pathways, diseases and genes to ABCA9 Recombinant Protein Antigen (NBP2-68700PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP)

Discover more about diseases related to ABCA9 Recombinant Protein Antigen (NBP2-68700PEP).
 

Pathways for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP)

View related products by pathway.

Research Areas for ABCA9 Recombinant Protein Antigen (NBP2-68700PEP)

Find related products by research area.

Blogs on ABCA9

There are no specific blogs for ABCA9, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA9
Novus 100% Guarantee