5-HT2B Antibody (4A4) - Azide and BSA Free

Western Blot: 5-HT2B Antibody (4A4) [H00003357-M01-100ug] - Detection against Immunogen (31.9 KDa) .

ELISA: 5-HT2B Antibody (4A4) [H00003357-M01-100ug] - Detection limit for recombinant GST tagged HTR2B is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

5-HT2B Antibody (4A4) - Azide and BSA Free Summary

• Immunogen: HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HTR2B
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5-HT2B Antibody (4A4) - Azide and BSA Free

• 5-HT(2B)
• 5HT2B
• 5-HT2B
• 5-HT-2B
• 5-HT2B5-HT 2B receptor
• 5-hydroxytryptamine (serotonin) receptor 2B
• 5-hydroxytryptamine 2B receptor
• 5-hydroxytryptamine receptor 2B
• HTR2B
• Serotonin receptor 2B

Background

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR2B
• Entrez:
  • 3357(Human)
• OMIM:
  • 601122(Human)
• Uniprot:
  • NP_000858(Human)