5-HT1E Antibody (2E9.)


Sandwich ELISA: 5-HT1E Antibody (2E9) [H00003354-M03] - Detection limit for recombinant GST tagged HTR1E is 0.3 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

5-HT1E Antibody (2E9.) Summary

HTR1E (NP_000856.1 206 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
Reacts with 5-hydroxytryptamine (serotonin) receptor 1E.
IgG2a Kappa
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Read Publication using H00003354-M03.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
Protein A purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5-HT1E Antibody (2E9.)

  • 5HT1E
  • 5-HT1E
  • 5-HT-1E
  • 5-hydroxytryptamine (serotonin) receptor 1E
  • HTR1E
  • S31
  • S31,5-HT1E5-hydroxytryptamine receptor 1E
  • Serotonin receptor 1E


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Ch, RM
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for 5-HT1E Antibody (H00003354-M03)(1)

Reviews for 5-HT1E Antibody (H00003354-M03) (0)

There are no reviews for 5-HT1E Antibody (H00003354-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT1E Antibody (H00003354-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional 5-HT1E Products

Bioinformatics Tool for 5-HT1E Antibody (H00003354-M03)

Discover related pathways, diseases and genes to 5-HT1E Antibody (H00003354-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT1E Antibody (H00003354-M03)

Discover more about diseases related to 5-HT1E Antibody (H00003354-M03).

Pathways for 5-HT1E Antibody (H00003354-M03)

View related products by pathway.

Research Areas for 5-HT1E Antibody (H00003354-M03)

Find related products by research area.

Blogs on 5-HT1E

There are no specific blogs for 5-HT1E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 5-HT1E Antibody (2E9.) and receive a gift card or discount.


Gene Symbol HTR1E