Recombinant Human 15-Lipoxygenase 2 Protein

Images

 
SDS-Page: Recombinant Human 15-Lipoxygenase 2 Protein [H00000247-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 15-Lipoxygenase 2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human ALOX15B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALOX15B

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris, pH 7.5 Reconstitute with deionized water.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 15-Lipoxygenase 2 Protein

  • 15-lipoxygenase 2
  • 15-LOX-B
  • arachidonate 15-lipoxygenase 2
  • arachidonate 15-lipoxygenase B
  • Arachidonate 15-lipoxygenase type II
  • arachidonate 15-lipoxygenase, second type
  • arachidonate 15-lipoxygenase, type B
  • arachidonate omega(6) lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.33,15-LOX-215S-lipoxygenase

Background

This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
H00000247-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01) (0)

There are no publications for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01) (0)

There are no reviews for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 15-Lipoxygenase 2 Products

Bioinformatics Tool for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01)

Discover related pathways, diseases and genes to 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01)

Discover more about diseases related to 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01).
 

Pathways for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01)

View related products by pathway.

PTMs for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01)

Learn more about PTMs related to 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01).
 

Research Areas for 15-Lipoxygenase 2 Partial Recombinant Protein (H00000247-Q01)

Find related products by research area.

Blogs on 15-Lipoxygenase 2

There are no specific blogs for 15-Lipoxygenase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 15-Lipoxygenase 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX15B