15-Lipoxygenase 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining in human prostate and endometrium tissues using anti-ALOX15B antibody. Corresponding ALOX15B RNA-seq data ...read more
Immunocytochemistry/ Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human cell line hTCEpi shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human prostate shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

15-Lipoxygenase 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWAD
Specificity
Specificity of human 15-Lipoxygenase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALOX15B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
15-Lipoxygenase 2 Recombinant Protein Antigen (NBP2-58984PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for 15-Lipoxygenase 2 Antibody

  • 15-lipoxygenase 2
  • 15-LOX-B
  • arachidonate 15-lipoxygenase 2
  • arachidonate 15-lipoxygenase B
  • Arachidonate 15-lipoxygenase type II
  • arachidonate 15-lipoxygenase, second type
  • arachidonate 15-lipoxygenase, type B
  • arachidonate omega(6) lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.33,15-LOX-215S-lipoxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46512
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-58984
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
6507-IL/CF
Species: Hu
NBP2-58984
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for 15-Lipoxygenase 2 Antibody (NBP2-58984) (0)

There are no publications for 15-Lipoxygenase 2 Antibody (NBP2-58984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 15-Lipoxygenase 2 Antibody (NBP2-58984) (0)

There are no reviews for 15-Lipoxygenase 2 Antibody (NBP2-58984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 15-Lipoxygenase 2 Antibody (NBP2-58984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 15-Lipoxygenase 2 Products

Bioinformatics Tool for 15-Lipoxygenase 2 Antibody (NBP2-58984)

Discover related pathways, diseases and genes to 15-Lipoxygenase 2 Antibody (NBP2-58984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-Lipoxygenase 2 Antibody (NBP2-58984)

Discover more about diseases related to 15-Lipoxygenase 2 Antibody (NBP2-58984).
 

Pathways for 15-Lipoxygenase 2 Antibody (NBP2-58984)

View related products by pathway.

PTMs for 15-Lipoxygenase 2 Antibody (NBP2-58984)

Learn more about PTMs related to 15-Lipoxygenase 2 Antibody (NBP2-58984).
 

Research Areas for 15-Lipoxygenase 2 Antibody (NBP2-58984)

Find related products by research area.

Blogs on 15-Lipoxygenase 2

There are no specific blogs for 15-Lipoxygenase 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 15-Lipoxygenase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX15B