15-Lipoxygenase 2 Antibody

Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining in human prostate and endometrium tissues using anti-ALOX15B antibody. Corresponding ALOX15B RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human cell line hTCEpi shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: 15-Lipoxygenase 2 Antibody [NBP2-58984] - Staining of human prostate shows high expression.

Product Discontinued

15-Lipoxygenase 2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWAD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALOX15B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 15-Lipoxygenase 2 Antibody

• 15-lipoxygenase 2
• 15-LOX-B
• arachidonate 15-lipoxygenase 2
• arachidonate 15-lipoxygenase B
• Arachidonate 15-lipoxygenase type II
• arachidonate 15-lipoxygenase, second type
• arachidonate 15-lipoxygenase, type B
• arachidonate omega(6) lipoxygenase
• EC 1.13.11
• EC 1.13.11.33,15-LOX-215S-lipoxygenase

Background

15 Lipoxygenase 2 encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALOX15B