Recombinant Human ZNF7 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ZNF7 Protein [H00007553-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ZNF7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 67-165 of Human ZNF7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF7 GST (N-Term) Protein

  • FLJ38706
  • HF.16
  • KOX4C2-H2 type zinc finger protein
  • zf30
  • zinc finger protein 7 (KOX 4, clone HF.16)
  • zinc finger protein 7
  • Zinc finger protein HF.16
  • Zinc finger protein KOX4
  • zinc finger protein zfp30
  • Zinc finger protein-7 (KOX4)

Background

ZNF7 - zinc finger protein 7 (KOX 4, clone HF.16)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80913
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-56078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ma, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051710-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-21020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP2-55735
Species: Hu
Applications: WB, ICC/IF
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-81052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79442
Species: Hu
Applications: WB
NBP2-46433
Species: Hu
Applications: WB, IHC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-81755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF7 Partial Recombinant Protein (H00007553-Q01) (0)

There are no publications for ZNF7 Partial Recombinant Protein (H00007553-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF7 Partial Recombinant Protein (H00007553-Q01) (0)

There are no reviews for ZNF7 Partial Recombinant Protein (H00007553-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF7 Partial Recombinant Protein (H00007553-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ZNF7 Products

Bioinformatics Tool for ZNF7 Partial Recombinant Protein (H00007553-Q01)

Discover related pathways, diseases and genes to ZNF7 Partial Recombinant Protein (H00007553-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF7 Partial Recombinant Protein (H00007553-Q01)

Discover more about diseases related to ZNF7 Partial Recombinant Protein (H00007553-Q01).
 

Pathways for ZNF7 Partial Recombinant Protein (H00007553-Q01)

View related products by pathway.

PTMs for ZNF7 Partial Recombinant Protein (H00007553-Q01)

Learn more about PTMs related to ZNF7 Partial Recombinant Protein (H00007553-Q01).

Blogs on ZNF7

There are no specific blogs for ZNF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF7