Recombinant Human ZNF673 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF673 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 98 of Human ZNF673 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPDVSIFASCILKCCY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF673
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF673 Protein

  • FLJ20344zinc finger protein 673
  • protein ZNF673
  • putative zinc finger transcription factor
  • zinc finger family member 673

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
AF5708
Species: Hu
Applications: WB, ICC
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5708
Species: Hu
Applications: WB, ICC
NBP2-13347
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82247
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-37244
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-14331
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF673 Recombinant Protein (H00055634-P01) (0)

There are no publications for ZNF673 Recombinant Protein (H00055634-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF673 Recombinant Protein (H00055634-P01) (0)

There are no reviews for ZNF673 Recombinant Protein (H00055634-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF673 Recombinant Protein (H00055634-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF673 Products

Bioinformatics Tool for ZNF673 Recombinant Protein (H00055634-P01)

Discover related pathways, diseases and genes to ZNF673 Recombinant Protein (H00055634-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF673 Recombinant Protein (H00055634-P01)

Discover more about diseases related to ZNF673 Recombinant Protein (H00055634-P01).

Blogs on ZNF673

There are no specific blogs for ZNF673, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF673 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF673