ZNF653 Antibody

Images

 
Western Blot: ZNF653 Antibody [NBP1-86828] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ZNF653 Antibody [NBP1-86828] - Staining of human lateral ventricle shows strong cytoplasmic positivity in subset of neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF653 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF653
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF653 Protein (NBP1-86828PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF653 Antibody

  • E430039K05Rik
  • zinc finger protein 653
  • Zinc finger protein Zip67,67 kDa zinc finger protein
  • ZIP67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-58704
Species: Hu
Applications: WB, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for ZNF653 Antibody (NBP1-86828) (0)

There are no publications for ZNF653 Antibody (NBP1-86828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF653 Antibody (NBP1-86828) (0)

There are no reviews for ZNF653 Antibody (NBP1-86828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF653 Antibody (NBP1-86828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF653 Products

Bioinformatics Tool for ZNF653 Antibody (NBP1-86828)

Discover related pathways, diseases and genes to ZNF653 Antibody (NBP1-86828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF653

There are no specific blogs for ZNF653, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF653 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF653