ZNF577 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF577 Antibody [NBP2-31026] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry: ZNF577 Antibody [NBP2-31026] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF577 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF577
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF577 Protein (NBP2-31026PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF577 Antibody

  • FLJ32291
  • MGC4400
  • zinc finger protein 577

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
AF8218
Species: Hu
Applications: WB, IHC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-32013
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-17028
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-05160
Species: Hu
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-31658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00153572-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB5808
Species: Hu
Applications: WB, ICC
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP1-78381
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB5628
Species: Hu, Mu
Applications: WB

Publications for ZNF577 Antibody (NBP2-31026) (0)

There are no publications for ZNF577 Antibody (NBP2-31026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF577 Antibody (NBP2-31026) (0)

There are no reviews for ZNF577 Antibody (NBP2-31026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF577 Antibody (NBP2-31026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF577 Products

Bioinformatics Tool for ZNF577 Antibody (NBP2-31026)

Discover related pathways, diseases and genes to ZNF577 Antibody (NBP2-31026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF577 Antibody (NBP2-31026)

Discover more about diseases related to ZNF577 Antibody (NBP2-31026).
 

Pathways for ZNF577 Antibody (NBP2-31026)

View related products by pathway.

PTMs for ZNF577 Antibody (NBP2-31026)

Learn more about PTMs related to ZNF577 Antibody (NBP2-31026).

Blogs on ZNF577

There are no specific blogs for ZNF577, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF577 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF577
Uniprot