ZNF420 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF420 Antibody [NBP2-55984] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF420 Antibody [NBP2-55984] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF420 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TAFLAGQQDRSDIYMSRRFTKSIFPVFFSVPTMWTSKLELRYSHGDFENGIWVLWIMEQKYRRSLQP
Specificity
Specificity of human ZNF420 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF420
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF420 Recombinant Protein Antigen (NBP2-55984PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF420 Antibody

  • FLJ20086
  • KIAA1584
  • MGC21637
  • MGC61687
  • SUHW4
  • Suppressor of hairy wing homolog 4
  • zinc finger protein 280D
  • Zinc finger protein 634
  • ZNF634suppressor of hairy wing homolog 4 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-76742
Species: Hu
Applications: WB, ELISA, ICC, IF
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ZNF420 Antibody (NBP2-55984) (0)

There are no publications for ZNF420 Antibody (NBP2-55984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF420 Antibody (NBP2-55984) (0)

There are no reviews for ZNF420 Antibody (NBP2-55984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF420 Antibody (NBP2-55984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF420 Antibody (NBP2-55984)

Discover related pathways, diseases and genes to ZNF420 Antibody (NBP2-55984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF420 Antibody (NBP2-55984)

Discover more about diseases related to ZNF420 Antibody (NBP2-55984).
 

Pathways for ZNF420 Antibody (NBP2-55984)

View related products by pathway.

PTMs for ZNF420 Antibody (NBP2-55984)

Learn more about PTMs related to ZNF420 Antibody (NBP2-55984).

Blogs on ZNF420

There are no specific blogs for ZNF420, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF420 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF420