ZNF23 Antibody

Images

 
Western Blot: ZNF23 Antibody [H00007571-B02P] - Analysis of ZNF23 expression in transfected 293T cell line by ZNF23 polyclonal antibody. Lane 1: ZNF23 transfected lysate(70.73 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF23 Antibody Summary

Immunogen
ZNF23 (NP_666016.1, 1 a.a. - 643 a.a.) full-length human protein. MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS
Specificity
ZNF23 - zinc finger protein 23 (KOX 16),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZNF23
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF23 Antibody

  • FLJ45745
  • MGC2555
  • NOLZ-1
  • zinc finger protein 503

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13557
Species: Hu
Applications: IHC, IHC-P
H00007580-B01P
Species: Hu
Applications: WB, ICC/IF
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55238
Species: Hu
Applications: ICC/IF
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-16528
Species: Hu
Applications: WB, ICC/IF
NBP1-81408
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-04299
Species: Hu
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
H00007571-B02P
Species: Hu
Applications: WB

Publications for ZNF23 Antibody (H00007571-B02P) (0)

There are no publications for ZNF23 Antibody (H00007571-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF23 Antibody (H00007571-B02P) (0)

There are no reviews for ZNF23 Antibody (H00007571-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF23 Antibody (H00007571-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF23 Products

Bioinformatics Tool for ZNF23 Antibody (H00007571-B02P)

Discover related pathways, diseases and genes to ZNF23 Antibody (H00007571-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF23 Antibody (H00007571-B02P)

Discover more about diseases related to ZNF23 Antibody (H00007571-B02P).
 

Pathways for ZNF23 Antibody (H00007571-B02P)

View related products by pathway.

Blogs on ZNF23

There are no specific blogs for ZNF23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF23
Entrez
Uniprot