ZNF140 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF140 Antibody [NBP2-13553] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF140 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKREVKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSS FKGGWKCKDHTEMLQENQGCIRKVTVSHQEAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF140
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF140 Protein (NBP2-13553PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF140 Antibody

  • EC 1.3.1.26
  • EC 2.1.1.43
  • pHZ-39
  • zinc finger protein 140 (clone pHZ-39)
  • zinc finger protein 140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45907
Species: Hu
Applications: WB, IHC
H00007695-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-79225
Species: Hu
Applications: WB
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13553
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF140 Antibody (NBP2-13553) (0)

There are no publications for ZNF140 Antibody (NBP2-13553).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF140 Antibody (NBP2-13553) (0)

There are no reviews for ZNF140 Antibody (NBP2-13553). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF140 Antibody (NBP2-13553) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF140 Products

Bioinformatics Tool for ZNF140 Antibody (NBP2-13553)

Discover related pathways, diseases and genes to ZNF140 Antibody (NBP2-13553). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF140 Antibody (NBP2-13553)

Discover more about diseases related to ZNF140 Antibody (NBP2-13553).

Blogs on ZNF140

There are no specific blogs for ZNF140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF140 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF140