ZMAT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Analysis in human thyroid gland and skin tissues. Corresponding ZMAT4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human cerebral cortex shows weak to moderate positivity in neurons.

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human thyroid gland shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

ChIP-Exo-Seq composite graph for Anti-ZMAT4 (NBP2-49619) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZMAT4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYH
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZMAT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZMAT4 Recombinant Protein Antigen (NBP2-49619PEP)

Reactivity Notes

Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZMAT4 Antibody - BSA Free

• FLJ13842
• zinc finger matrin-type protein 4
• zinc finger, matrin type 4
• zinc finger, matrin-type 4

Background

ZMAT4, also known as Zinc finger matrin-type protein 4, has a 229 amino acid long isoform that is 26 kDa and a short 153 amino acid isoform that is approx. 17 kDa. This protein commonly found in the nucleus, is related to DNA binding, metal ion binding and zinc ion binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMAT4