ZIC4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZIC4 Antibody [NBP2-37867] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry: ZIC4 Antibody [NBP2-37867] - Staining of human cerebral cortex shows nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZIC4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNL
Specificity
Specificity of human ZIC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZIC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZIC4 Protein (NBP2-37867PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZIC4 Antibody

  • FLJ42609
  • FLJ45833
  • Zic family member 4
  • Zinc finger protein of the cerebellum 4zinc family member 4 protein HZIC4
  • zinc finger protein ZIC 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24607
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
AF5310
Species: Hu, Mu
Applications: WB, ICC
NBP1-50469
Species: Hu, Mk, Pm
Applications: WB (-), ELISA, IHC-P
H00116443-R01
Species: Hu
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP1-33419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00131096-R03
Species: Hu
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37867
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZIC4 Antibody (NBP2-37867) (0)

There are no publications for ZIC4 Antibody (NBP2-37867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIC4 Antibody (NBP2-37867) (0)

There are no reviews for ZIC4 Antibody (NBP2-37867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZIC4 Antibody (NBP2-37867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZIC4 Antibody (NBP2-37867)

Discover related pathways, diseases and genes to ZIC4 Antibody (NBP2-37867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIC4 Antibody (NBP2-37867)

Discover more about diseases related to ZIC4 Antibody (NBP2-37867).
 

Pathways for ZIC4 Antibody (NBP2-37867)

View related products by pathway.

PTMs for ZIC4 Antibody (NBP2-37867)

Learn more about PTMs related to ZIC4 Antibody (NBP2-37867).

Blogs on ZIC4

There are no specific blogs for ZIC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZIC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIC4
Uniprot