ZG16 Antibody


Western Blot: ZG16 Antibody [NBP2-30568] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry: ZG16 Antibody [NBP2-30568] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ZG16 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZG16 Protein (NBP2-30568PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZG16 Antibody

  • hZG16
  • JCLN
  • JCLN1
  • MGC34820
  • ZG16A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZG16 Antibody (NBP2-30568) (0)

There are no publications for ZG16 Antibody (NBP2-30568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZG16 Antibody (NBP2-30568) (0)

There are no reviews for ZG16 Antibody (NBP2-30568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZG16 Antibody (NBP2-30568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZG16 Products

Bioinformatics Tool for ZG16 Antibody (NBP2-30568)

Discover related pathways, diseases and genes to ZG16 Antibody (NBP2-30568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZG16 Antibody (NBP2-30568)

Discover more about diseases related to ZG16 Antibody (NBP2-30568).

Pathways for ZG16 Antibody (NBP2-30568)

View related products by pathway.

Blogs on ZG16

There are no specific blogs for ZG16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZG16 Antibody and receive a gift card or discount.


Gene Symbol ZG16