![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Analysis in human rectum and testis tissues using NBP2-30568 antibody. Corresponding ZG16 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-Paraffin-NBP2-30568-img0012.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Analysis in human rectum and testis tissues using NBP2-30568 antibody. Corresponding ZG16 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ZG16 Antibody - BSA Free (NBP2-30568) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZG16 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human colon, liver, rectum and testis using Anti-ZG16 antibody NBP2-30568 (A) shows similar protein distribution across tissues to independent antibody NBP2-30488 (B).](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-Paraffin-NBP2-30568-img0007.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human colon, liver, rectum and testis using Anti-ZG16 antibody NBP2-30568 (A) shows similar protein distribution across tissues to independent antibody NBP2-30488 (B).")
![Western Blot: ZG16 Antibody [NBP2-30568] - Analysis in control (vector only transfected HEK293T lysate) and ZG16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ZG16-Antibody-Western-Blot-NBP2-30568-img0006.jpg "Western Blot: ZG16 Antibody [NBP2-30568] - Analysis in control (vector only transfected HEK293T lysate) and ZG16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human testis shows no positivity in cells in seminiferious ducts as expected.](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-Paraffin-NBP2-30568-img0013.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human testis shows no positivity in cells in seminiferious ducts as expected.")
![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-NBP2-30568-img0001.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-Paraffin-NBP2-30568-img0003.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human rectum shows high expression.](http://images.novusbio.com/fullsize/ZG16-Antibody-Immunohistochemistry-Paraffin-NBP2-30568-img0004.jpg "Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30568] - Staining of human rectum shows high expression.")
![Western Blot PAUF/ZG16B Antibody (817310) [Unconjugated]](https://images.novusbio.com/images2/PAUF_MAB7777_Western_Blot_12713.jpg)
![Immunohistochemistry PAUF/ZG16B Antibody (817310) [Unconjugated]](https://images.novusbio.com/images2/PAUF_MAB7777_Immunohistochemistry_12735.jpg)
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")