ZDHHC4 Antibody

Western Blot: ZDHHC4 Antibody [NBP1-83858] - Analysis in control (vector only transfected HEK293T lysate) and ZDHHC4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ZDHHC4 Antibody [NBP1-83858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Discontinued

ZDHHC4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZDHHC4 Protein (NBP1-83858PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZDHHC4 Antibody

• DHHC domain containing 4
• DHHC-4
• EC 2.3.1
• EC 2.3.1.-
• Zinc finger protein 374
• zinc finger, DHHC-type containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC4