ZDHHC23 Antibody

Western Blot: ZDHHC23 Antibody [NBP1-82688] - Analysis in control (vector only transfected HEK293T lysate) and ZDHHC23 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406481).

Immunocytochemistry/Immunofluorescence: ZDHHC23 Antibody [NBP1-82688] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ZDHHC23 Antibody [NBP1-82688] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: ZDHHC23 Antibody [NBP1-82688] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

Immunohistochemistry-Paraffin: ZDHHC23 Antibody [NBP1-82688] - Staining of human renal cancer shows moderate membranous and cytoplasmic positivity in tumor cells.

Product Discontinued

ZDHHC23 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC23
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZDHHC23 Antibody

• DHHC domain containing 23
• EC 2.3.1.-
• NIDD
• zinc finger, DHHC-type containing 23

Background

ZDHHC23 may be involved in NOS1 regulation and targeting to the synaptic membrane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC23