ZDHHC23 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDHHC23 Antibody [NBP1-82688] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZDHHC23 Antibody [NBP1-82688] - Staining of human colon shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC23 Protein (NBP1-82688PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC23 Antibody

  • DHHC domain containing 23
  • EC 2.3.1.-
  • NIDD
  • zinc finger, DHHC-type containing 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-16155
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF3145
Species: Hu
Applications: WB
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB110-59906
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
NBL1-12547
Species: Hu
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-12553
Species: Hu
NBP2-35213
Species: Hu
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for ZDHHC23 Antibody (NBP1-82688) (0)

There are no publications for ZDHHC23 Antibody (NBP1-82688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC23 Antibody (NBP1-82688) (0)

There are no reviews for ZDHHC23 Antibody (NBP1-82688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC23 Antibody (NBP1-82688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC23 Products

Bioinformatics Tool for ZDHHC23 Antibody (NBP1-82688)

Discover related pathways, diseases and genes to ZDHHC23 Antibody (NBP1-82688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZDHHC23 Antibody (NBP1-82688)

View related products by pathway.

PTMs for ZDHHC23 Antibody (NBP1-82688)

Learn more about PTMs related to ZDHHC23 Antibody (NBP1-82688).

Blogs on ZDHHC23

There are no specific blogs for ZDHHC23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC23