DYDC2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DYDC2 Antibody [NBP1-88778] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: DYDC2 Antibody [NBP1-88778] - Staining of human bronchus shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DYDC2 Protein (NBP1-88778PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DYDC2 Antibody

  • bA36D19.6
  • DPY30 domain containing 2
  • DPY30 domain-containing protein 2
  • MGC16186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41344
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, MiAr, PA
NBP1-88536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3927
Species: Hu, Mu, Rt
Applications: WB
NBP1-98277
Species: Hu
Applications: WB
NBP1-90896
Species: Hu
Applications: IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58228
Species: Hu
Applications: ICC/IF
AF8107
Species: Hu
Applications: WB, IHC
NBP1-86202
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DYDC2 Antibody (NBP1-88778) (0)

There are no publications for DYDC2 Antibody (NBP1-88778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYDC2 Antibody (NBP1-88778) (0)

There are no reviews for DYDC2 Antibody (NBP1-88778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DYDC2 Antibody (NBP1-88778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYDC2 Products

Bioinformatics Tool for DYDC2 Antibody (NBP1-88778)

Discover related pathways, diseases and genes to DYDC2 Antibody (NBP1-88778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYDC2 Antibody (NBP1-88778)

Discover more about diseases related to DYDC2 Antibody (NBP1-88778).

Blogs on DYDC2

There are no specific blogs for DYDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYDC2