ZCCHC17 Recombinant Protein Antigen

Images

 
There are currently no images for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZCCHC17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZCCHC17

Source: E.coli

Amino Acid Sequence: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZCCHC17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68707. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ZCCHC17 Recombinant Protein Antigen

  • HSPC251
  • nucleolar protein of 40 kDa
  • Pnn-interacting nucleolar protein
  • pNO40nucleolar protein 40
  • PS1D protein
  • PS1DRP11-266K22.1
  • putative S1 RNA binding domain protein
  • Putative S1 RNA-binding domain protein
  • Zinc finger CCHC domain-containing protein 17
  • zinc finger, CCHC domain containing 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF6646
Species: Hu
Applications: WB
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
H00051329-M09
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-61674
Species: Hu
Applications: WB, ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-88723
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP) (0)

There are no publications for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP) (0)

There are no reviews for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ZCCHC17 Products

Bioinformatics Tool for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP)

Discover related pathways, diseases and genes to ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZCCHC17 Recombinant Protein Antigen (NBP2-68707PEP)

View related products by pathway.

Blogs on ZCCHC17

There are no specific blogs for ZCCHC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZCCHC17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCCHC17