Recombinant Human ZC3H7A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZC3H7A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human ZC3H7A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSFLFKDLN

Protein/Peptide Type
Recombinant Protein
Gene
ZC3H7A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZC3H7A Protein

  • FLJ10027
  • FLJ20318
  • HSPC055
  • ZC3H7
  • ZC3HDC7
  • zinc finger CCCH domain-containing protein 7A
  • zinc finger CCCH type domain containing 7
  • zinc finger CCCH-type containing 7
  • zinc finger CCCH-type containing 7A
  • zinc finger CCCH-type domain containing 7
  • zinc-finger protein AY163807

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13665
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83587
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-91249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59007
Species: Hu, Mu
Applications: WB
NBP2-30746
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85635
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBL1-12154
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ZC3H7A Recombinant Protein (H00029066-P01) (0)

There are no publications for ZC3H7A Recombinant Protein (H00029066-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H7A Recombinant Protein (H00029066-P01) (0)

There are no reviews for ZC3H7A Recombinant Protein (H00029066-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZC3H7A Recombinant Protein (H00029066-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZC3H7A Products

Bioinformatics Tool for ZC3H7A Recombinant Protein (H00029066-P01)

Discover related pathways, diseases and genes to ZC3H7A Recombinant Protein (H00029066-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H7A Recombinant Protein (H00029066-P01)

Discover more about diseases related to ZC3H7A Recombinant Protein (H00029066-P01).
 

Pathways for ZC3H7A Recombinant Protein (H00029066-P01)

View related products by pathway.

Blogs on ZC3H7A

There are no specific blogs for ZC3H7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZC3H7A Antibody
NBP1-82187

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZC3H7A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H7A