ZC3H3 Antibody

Images

 
Western Blot: ZC3H3 Antibody [NBP1-74066] - Mouse Pancreas Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Zc3h3. Immunizing peptide sequence KEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGAR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Zc3h3 and was validated on Western blot.
Theoretical MW
105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZC3H3 Antibody

  • KIAA0150zinc finger CCCH-type domain containing 3
  • ZC3HDC3
  • zinc finger CCCH domain-containing protein 3
  • zinc finger CCCH type domain containing 3
  • zinc finger CCCH-type containing 3

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33422
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38421
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP1-91861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
H00084948-R01
Species: Hu
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84951
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-74066
Species: Mu
Applications: WB

Publications for ZC3H3 Antibody (NBP1-74066) (0)

There are no publications for ZC3H3 Antibody (NBP1-74066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H3 Antibody (NBP1-74066) (0)

There are no reviews for ZC3H3 Antibody (NBP1-74066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZC3H3 Antibody (NBP1-74066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H3 Products

Bioinformatics Tool for ZC3H3 Antibody (NBP1-74066)

Discover related pathways, diseases and genes to ZC3H3 Antibody (NBP1-74066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZC3H3 Antibody (NBP1-74066)

View related products by pathway.

Blogs on ZC3H3

There are no specific blogs for ZC3H3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H3
Uniprot