Recombinant Human ZBTB46 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZBTB46 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 589 of Human ZBTB46 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPEDPRGEAEELGEDDEGLAPEDALLADDKDEEDSPRPRSPPGGPDKDFAWLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZBTB46
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZBTB46 Protein

  • BTB (POZ) domain containing 4
  • BTB/POZ domain-containing protein 4
  • BTBD4
  • dJ583P15.7
  • dJ583P15.8
  • FLJ13502
  • RINZF
  • zinc finger and BTB domain containing 46
  • zinc finger and BTB domain-containing protein 46
  • Zinc finger protein 340
  • ZNF340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
259-HE
Species: Hu
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-89369
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47324
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00140685-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZBTB46 Recombinant Protein (H00140685-P01) (0)

There are no publications for ZBTB46 Recombinant Protein (H00140685-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB46 Recombinant Protein (H00140685-P01) (0)

There are no reviews for ZBTB46 Recombinant Protein (H00140685-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBTB46 Recombinant Protein (H00140685-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZBTB46 Products

Bioinformatics Tool for ZBTB46 Recombinant Protein (H00140685-P01)

Discover related pathways, diseases and genes to ZBTB46 Recombinant Protein (H00140685-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB46 Recombinant Protein (H00140685-P01)

Discover more about diseases related to ZBTB46 Recombinant Protein (H00140685-P01).

PTMs for ZBTB46 Recombinant Protein (H00140685-P01)

Learn more about PTMs related to ZBTB46 Recombinant Protein (H00140685-P01).

Blogs on ZBTB46

There are no specific blogs for ZBTB46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HB-EGF
259-HE-050
ZBTB46 Antibody
NBP2-27211

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZBTB46 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB46