ZBBX Antibody - BSA Free

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human cerebral cortex.

Immunohistochemistry: ZBBX Antibody [NBP2-38294] - Staining of human fallopian tube shows strong positivity in ciliated cells.

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining in human fallopian tube and colon tissues using anti-ZBBX antibody. Corresponding ZBBX RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human cerebral cortex, fallopian tube, lymph node and testis using Anti-ZBBX antibody NBP2-38294 (A) shows similar protein distribution across tissues to independent antibody NBP1-82092 (B).

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human testis.

Immunohistochemistry-Paraffin: ZBBX Antibody [NBP2-38294] - Staining of human lymph node.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZBBX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZBBX Antibody - BSA Free (NBP2-38294) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHTLDNLEKELQVLRSLADTSEKLYSLTSEEFPDFSSQSLNISQISTDFLKTSHVRGPCGVEELSCSGRDTKIQSLLSLSESSTDEEEEDFLNKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBBX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZBBX Protein (NBP2-38294PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZBBX Antibody - BSA Free

• zinc finger, B-box domain containing

Background

ZBBX is a gene that codes for a protein with two isoforms, measuring 800 and 839 amino acids in length with weights of approximately 91 and 96 kDa respectively. Current research is being done on diseases and disorders linked to this gene including attention deficit hyperactivity disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBBX
• Uniprot:
  • A8MT70(Human)