Recombinant Human XE7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human XE7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 53-156 of Human SFRS17A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AKAP17A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human XE7 Protein

  • A kinase (PRKA) anchor protein 17A
  • AKAP-17A
  • A-kinase anchor protein 17A
  • B-lymphocyte antigen
  • B-lymphocyte surface antigen
  • CCDC133
  • CXYorf3
  • DXYS155EPRKA17A
  • MGC39904
  • Protein kinase A-anchoring protein 17A
  • Protein XE7
  • pseudoautosomal gene XE7
  • SFRS17AMGC125366
  • Splicing factor, arginine/serine-rich 17AFLJ98315,721PMGC125365
  • XE7chromosome X and Y open reading frame 3
  • XE7Y

Background

RP13-297E16.1 - DNA segment on chromosome X and Y (unique) 155 expressed sequence

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009406-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
AF5540
Species: Mu
Applications: WB
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84333
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43801
Species: Hu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB6917
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00008227-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for XE7 Partial Recombinant Protein (H00008227-Q01) (0)

There are no publications for XE7 Partial Recombinant Protein (H00008227-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XE7 Partial Recombinant Protein (H00008227-Q01) (0)

There are no reviews for XE7 Partial Recombinant Protein (H00008227-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XE7 Partial Recombinant Protein (H00008227-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XE7 Products

Bioinformatics Tool for XE7 Partial Recombinant Protein (H00008227-Q01)

Discover related pathways, diseases and genes to XE7 Partial Recombinant Protein (H00008227-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for XE7 Partial Recombinant Protein (H00008227-Q01)

View related products by pathway.

PTMs for XE7 Partial Recombinant Protein (H00008227-Q01)

Learn more about PTMs related to XE7 Partial Recombinant Protein (H00008227-Q01).

Blogs on XE7

There are no specific blogs for XE7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg
XE7 Antibody (2G8)
H00008227-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human XE7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP17A