Wnt-8a Antibody

Images

 
Western Blot: Wnt-8a Antibody [H00007478-D01P] - Analysis of WNT8A expression in transfected 293T cell line by WNT8A polyclonal antibody.Lane 1: WNT8A transfected lysate(38.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-8a Antibody Summary

Immunogen
WNT8A (NP_490645.1, 1 a.a. - 351 a.a.) full-length human protein. MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA
Specificity
Reacts with wingless-type MMTV integration site family, member 8A.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT8A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Wnt-8a Antibody

  • protein Wnt-8a
  • Protein Wnt-8d
  • wingless-type MMTV integration site family, member 8A
  • Wnt8a
  • Wnt-8a
  • WNT8DWNT8d

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. It encodes a protein which shows 81% amino acid identity to the mouse Wnt8A protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46367
Species: Hu
Applications: WB, IHC
3900-WN/CF
Species: Mu
AF3367
Species: Hu, Mu
Applications: WB
AF6116
Species: Hu
Applications: WB, ICC
AF3157
Species: Hu
Applications: WB, IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF1620
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
7196-WN/CF
Species: Hu
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Wnt-8a Antibody (H00007478-D01P) (0)

There are no publications for Wnt-8a Antibody (H00007478-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-8a Antibody (H00007478-D01P) (0)

There are no reviews for Wnt-8a Antibody (H00007478-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-8a Antibody (H00007478-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-8a Products

Bioinformatics Tool for Wnt-8a Antibody (H00007478-D01P)

Discover related pathways, diseases and genes to Wnt-8a Antibody (H00007478-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-8a Antibody (H00007478-D01P)

Discover more about diseases related to Wnt-8a Antibody (H00007478-D01P).
 

Pathways for Wnt-8a Antibody (H00007478-D01P)

View related products by pathway.

PTMs for Wnt-8a Antibody (H00007478-D01P)

Learn more about PTMs related to Wnt-8a Antibody (H00007478-D01P).
 

Research Areas for Wnt-8a Antibody (H00007478-D01P)

Find related products by research area.

Blogs on Wnt-8a

There are no specific blogs for Wnt-8a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-8a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT8A
Entrez
Uniprot