WDR57 Antibody

Images

 
Genetic Strategies: Western Blot: WDR57 Antibody [NBP1-92585] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: WDR57 Antibody [NBP1-92585] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDR57 Antibody [NBP1-92585] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Western Blot: WDR57 Antibody [NBP1-92585] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

WDR57 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRNP40
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR57 Protein (NBP1-92585PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR57 Antibody

  • 38 kDa-splicing factor
  • HPRP8BP
  • Prp8-binding protein
  • PRP8BP40K
  • PRPF8BPFLJ41108
  • RP11-490K7.3
  • SFP38
  • small nuclear ribonucleoprotein 40kDa (U5)
  • SPF38MGC1910
  • U5 small nuclear ribonucleoprotein 40 kDa protein
  • U5 snRNP 40 kDa protein
  • U5 snRNP-specific 40 kDa protein (hPrp8-binding)
  • U5 snRNP-specific 40 kDa protein
  • U5-40K
  • U5-40kD protein
  • WD repeat domain 57 (U5 snRNP specific)
  • WD repeat-containing protein 57
  • WDR57

Background

WDR57 encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR57 Antibody (NBP1-92585) (0)

There are no publications for WDR57 Antibody (NBP1-92585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR57 Antibody (NBP1-92585) (0)

There are no reviews for WDR57 Antibody (NBP1-92585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDR57 Antibody (NBP1-92585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR57 Products

Research Areas for WDR57 Antibody (NBP1-92585)

Find related products by research area.

Blogs on WDR57

There are no specific blogs for WDR57, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRNP40