WDR57 Antibody

Western Blot: WDR57 Antibody [NBP1-92585] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: WDR57 Antibody [NBP1-92585] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WDR57 Antibody [NBP1-92585] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Western Blot: WDR57 Antibody [NBP1-92585] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

WDR57 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRNP40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WDR57 Protein (NBP1-92585PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR57 Antibody

• 38 kDa-splicing factor
• HPRP8BP
• Prp8-binding protein
• PRP8BP40K
• PRPF8BPFLJ41108
• RP11-490K7.3
• SFP38
• small nuclear ribonucleoprotein 40kDa (U5)
• SPF38MGC1910
• U5 small nuclear ribonucleoprotein 40 kDa protein
• U5 snRNP 40 kDa protein
• U5 snRNP-specific 40 kDa protein (hPrp8-binding)
• U5 snRNP-specific 40 kDa protein
• U5-40K
• U5-40kD protein
• WD repeat domain 57 (U5 snRNP specific)
• WD repeat-containing protein 57
• WDR57

Background

WDR57 encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRNP40