WDR34 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR34 Antibody [NBP1-88806] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry: WDR34 Antibody [NBP1-88806] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR34 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR34
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR34 Protein (NBP1-88806PEP)
Publications
Read Publication using
NBP1-88806 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%). Human reactivity reported in scientific literature (PMID: 26077881).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR34 Antibody

  • bA216B9.3
  • MGC20486
  • WD repeat domain 34
  • WD repeat-containing protein 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP2-26506
Species: Hu, Mu, Rt
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-46200
Species: Hu, Mu
Applications: WB, IP
NB100-56363
Species: Hu, Mu
Applications: WB
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-46228
Species: Hu
Applications: WB, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88806
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for WDR34 Antibody (NBP1-88806)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for WDR34 Antibody (NBP1-88806) (0)

There are no reviews for WDR34 Antibody (NBP1-88806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR34 Antibody (NBP1-88806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR34 Products

Bioinformatics Tool for WDR34 Antibody (NBP1-88806)

Discover related pathways, diseases and genes to WDR34 Antibody (NBP1-88806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR34 Antibody (NBP1-88806)

Discover more about diseases related to WDR34 Antibody (NBP1-88806).

Blogs on WDR34

There are no specific blogs for WDR34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR34