WDR34 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR34 Antibody [NBP1-88806] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry: WDR34 Antibody [NBP1-88806] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR34 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WDR34 Antibody - BSA Free (NBP1-88806) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-WDR34 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR34
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 26077881). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WDR34 Protein (NBP1-88806PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%). Human reactivity reported in scientific literature (PMID: 26077881).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR34 Antibody - BSA Free

• bA216B9.3
• MGC20486
• WD repeat domain 34
• WD repeat-containing protein 34

Background

WDR34 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR34 Antibody (NBP1-88806)(1)

Publication using NBP1-88806

• Taylor SP, Dantas TJ, Duran I et al. Mutations in DYNC2LI1 disrupt cilia function and cause short rib polydactyly syndrome. Nat Commun 2015-06-16 [PMID: 26077881] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: WDR34