Western Blot: WDR34 Antibody [NBP1-88805] - Sucrose density gradient centrifugation of cell lysates from RPE1 cells. RPE1 cells were lysed and loaded onto a 5-40% sucrose density gradient. After centrifugation, 1-ml ...read more
Immunocytochemistry/ Immunofluorescence: WDR34 Antibody [NBP1-88805] - Localization of mGFP-WDR34. Cells expressing mGFP-WDR34 were fixed with paraformaldehyde and labeled to detect acetylated tubulin and WDR34, as ...read more
Immunohistochemistry-Paraffin: WDR34 Antibody [NBP1-88805] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Genetic Strategies: Western Blot: WDR34 Antibody [NBP1-88805] - The stabilities of WDR34 and WDR60 are interdependent. Immunoblotting confirmed the efficacy of WDR34 and WDR60 siRNAs. Immunoblotting for WDR34 ...read more
Genetic Strategies: Knockout Validated: WDR34 Antibody [NBP1-88805] - HA-WDR34 (NBP1-88805) and HA-WDR60 (NBP1-90437) expression in WT and KO cells. (A) Pull down of HA-WDR60 in WT and WDR34 KO cells. HA-WDR60 ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - Immunoprecipitation from serum-starved RPE1 cells stably expressing either mGFP or mGFP–WDR34. GFP-traps of cells expressing mGFP alone or mGFP–WDR34 were separated by ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - (A) RNAi of WDR34 & WDR60 validated by immunoblotting with GAPODH as a loading control.(B) Immunofluorescence of TMEM67 & RPGRIP1L in WDR34 & WDR60 depleted cells. TMEM67 is ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - CRISPR control cells lines show no defect in ciliogenesis.(A & B) Immunoblotting for WDR34 & WDR60 in WT & KO cells. (A) A 52 kDa band, corresponding to WDR34 is lost in WDR34 ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - HA-WDR34 & HA-WDR60 expression in WT & KO cells.(A) Pull down of HA-WDR60 in WT & WDR34 KO cells. HA-WDR60 pulls down WDR34 in WT but not in KO cells (B) Pull down of HA-WDR34 ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - HA-WDR34 & HA-WDR60 expression in WT & KO cells.(A) Pull down of HA-WDR60 in WT & WDR34 KO cells. HA-WDR60 pulls down WDR34 in WT but not in KO cells (B) Pull down of HA-WDR34 ...read more
Immunocytochemistry/ Immunofluorescence: WDR34 Antibody [NBP1-88805] - Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. ...read more
Western Blot: WDR34 Antibody [NBP1-88805] - Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. (B) LIC3/DYNC2LI1 ...read more
Immunocytochemistry/ Immunofluorescence: WDR34 Antibody [NBP1-88805] - Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. ...read more
Immunocytochemistry/ Immunofluorescence: WDR34 Antibody [NBP1-88805] - Dynein-2 assembly in primary cilium.(A) Immunoblotting for WDR60 & WDR34 in WT, WDR34 KO#1 & WDR60 KO cells. Arrows indicate WDR34 & WDR60 proteins. ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: APPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKV
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR34
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for WDR34 Antibody - BSA Free
bA216B9.3
MGC20486
WD repeat domain 34
WD repeat-containing protein 34
Background
WDR34 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our WDR34 Antibody - BSA Free and receive a gift card or discount.