VABP Antibody

Images

 
Western Blot: VABP Antibody [NBP2-88563] - WB Suggested Anti-KCNIP1 Antibody Titration: 1.35ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry: VABP Antibody [NBP2-88563] - Human Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VABP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human VABP. Peptide sequence: FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNIP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for VABP Antibody

  • A-type potassium channel modulatory protein 1
  • KChIP1
  • KCHIP1MGC95
  • Kv channel interacting protein 1
  • Kv channel-interacting protein 1
  • potassium channel interacting protein 1
  • Potassium channel-interacting protein 1
  • VABP
  • Vesicle APC-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03748
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-76945
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00030818-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-84105
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81336
Species: Hu, In
Applications: IHC, IHC-P, WB
NB300-279
Species: Mu, Rt
Applications: IHC, IHC-Fr, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00003208-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-47481
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NBP1-89112
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-88563
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VABP Antibody (NBP2-88563) (0)

There are no publications for VABP Antibody (NBP2-88563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VABP Antibody (NBP2-88563) (0)

There are no reviews for VABP Antibody (NBP2-88563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VABP Antibody (NBP2-88563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VABP Products

Bioinformatics Tool for VABP Antibody (NBP2-88563)

Discover related pathways, diseases and genes to VABP Antibody (NBP2-88563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VABP Antibody (NBP2-88563)

Discover more about diseases related to VABP Antibody (NBP2-88563).
 

Pathways for VABP Antibody (NBP2-88563)

View related products by pathway.

PTMs for VABP Antibody (NBP2-88563)

Learn more about PTMs related to VABP Antibody (NBP2-88563).
 

Research Areas for VABP Antibody (NBP2-88563)

Find related products by research area.

Blogs on VABP

There are no specific blogs for VABP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNIP1