UTP18 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human UTP18 (NP_057085). Peptide sequence PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UTP18 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
62 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for UTP18 Antibody - BSA Free
Background
UTP18/WDR50 is a component of the small-subunit (SSU) processome, a large ribonucleoprotein complex that participates in ribosomal RNA processing and ribosome assembly. UTP18/WDR50 is a member of the WD repeat family. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for UTP18 Antibody (NBP3-10541) (0)
There are no publications for UTP18 Antibody (NBP3-10541).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UTP18 Antibody (NBP3-10541) (0)
There are no reviews for UTP18 Antibody (NBP3-10541).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UTP18 Antibody (NBP3-10541) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UTP18 Products
Research Areas for UTP18 Antibody (NBP3-10541)
Find related products by research area.
|
Blogs on UTP18