USP9Y Antibody

Images

 
Western Blot: USP9Y Antibody [NBP1-79749] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP9Y Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP9Y
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against USP9Y and was validated on Western blot.
Theoretical MW
291 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP9Y Antibody

  • Deubiquitinating enzyme FAF-Y
  • DFFRYFLJ33043
  • EC 3.1.2.15
  • EC 3.4.19.12
  • Fat facets protein-related, Y-linked
  • probable ubiquitin carboxyl-terminal hydrolase FAF-Y
  • ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila)
  • ubiquitin specific peptidase 9, Y-linked
  • ubiquitin thioesterase FAF-Y
  • Ubiquitin thiolesterase FAF-Y
  • ubiquitin-specific processing protease FAF-Y
  • Ubiquitin-specific protease 9, Y chromosome
  • Ubiquitin-specific-processing protease FAF-Y

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92850
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-94768
Species: Mu, Rt
Applications: WB
22240002
Species: Hu
Applications: WB, ELISA
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-20948
Species: Hu
Applications: WB
NBP1-98290
Species: Hu
Applications: WB
H00009087-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for USP9Y Antibody (NBP1-79749) (0)

There are no publications for USP9Y Antibody (NBP1-79749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP9Y Antibody (NBP1-79749) (0)

There are no reviews for USP9Y Antibody (NBP1-79749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP9Y Antibody (NBP1-79749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP9Y Products

Array NBP1-79749

Bioinformatics Tool for USP9Y Antibody (NBP1-79749)

Discover related pathways, diseases and genes to USP9Y Antibody (NBP1-79749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP9Y Antibody (NBP1-79749)

Discover more about diseases related to USP9Y Antibody (NBP1-79749).
 

Pathways for USP9Y Antibody (NBP1-79749)

View related products by pathway.

Blogs on USP9Y

There are no specific blogs for USP9Y, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP9Y Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP9Y
Uniprot