USP42 Antibody

Images

 
Immunohistochemistry-Paraffin: USP42 Antibody [NBP1-83715] - Staining of human kidney shows strong nuclear cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USP42 Protein (NBP1-83715PEP)
Publications
Read Publications using
NBP1-83715 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25336640).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP42 Antibody

  • Deubiquitinating enzyme 42
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ12697
  • ubiquitin carboxyl-terminal hydrolase 42
  • ubiquitin specific peptidase 42
  • ubiquitin specific protease 42
  • ubiquitin thioesterase 42
  • Ubiquitin thiolesterase 42
  • Ubiquitin-specific-processing protease 42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83715
Species: Hu
Applications: IHC, IHC-P

Publications for USP42 Antibody (NBP1-83715)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for USP42 Antibody (NBP1-83715) (0)

There are no reviews for USP42 Antibody (NBP1-83715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for USP42 Antibody (NBP1-83715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP42 Products

Bioinformatics Tool for USP42 Antibody (NBP1-83715)

Discover related pathways, diseases and genes to USP42 Antibody (NBP1-83715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP42 Antibody (NBP1-83715)

Discover more about diseases related to USP42 Antibody (NBP1-83715).
 

Pathways for USP42 Antibody (NBP1-83715)

View related products by pathway.

PTMs for USP42 Antibody (NBP1-83715)

Learn more about PTMs related to USP42 Antibody (NBP1-83715).

Blogs on USP42

There are no specific blogs for USP42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP42