USP38 Antibody


Immunocytochemistry/ Immunofluorescence: USP38 Antibody [NBP2-58097] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & centrosome.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

USP38 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPS
Specificity of human USP38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP38 Recombinant Protein Antigen (NBP2-58097PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for USP38 Antibody

  • Deubiquitinating enzyme 38
  • EC
  • HP43.8KDFLJ35970
  • KIAA1891ubiquitin specific protease 38
  • ubiquitin carboxyl-terminal hydrolase 38
  • ubiquitin specific peptidase 38
  • ubiquitin thioesterase 38
  • Ubiquitin thiolesterase 38
  • Ubiquitin-specific-processing protease 38


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for USP38 Antibody (NBP2-58097) (0)

There are no publications for USP38 Antibody (NBP2-58097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP38 Antibody (NBP2-58097) (0)

There are no reviews for USP38 Antibody (NBP2-58097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP38 Antibody (NBP2-58097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for USP38 Antibody (NBP2-58097)

Discover related pathways, diseases and genes to USP38 Antibody (NBP2-58097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP38 Antibody (NBP2-58097)

Discover more about diseases related to USP38 Antibody (NBP2-58097).

Pathways for USP38 Antibody (NBP2-58097)

View related products by pathway.

Blogs on USP38

There are no specific blogs for USP38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our USP38 Antibody and receive a gift card or discount.


Gene Symbol USP38