USP34 Antibody (2E2)

Images

 
Western Blot: USP34 Antibody (2E2) [H00009736-M01] - USP34 expression in A-549 ( Cat # L025V1 ).
Immunocytochemistry/ Immunofluorescence: USP34 Antibody (2E2) [H00009736-M01] - Analysis of monoclonal antibody to USP34 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: USP34 Antibody (2E2) [H00009736-M01] - Analysis of monoclonal antibody to USP34 on formalin-fixed paraffin-embedded human seminoma. Antibody concentration 3 ug/ml.
ELISA: USP34 Antibody (2E2) [H00009736-M01] - Detection limit for recombinant GST tagged USP34 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP34 Antibody (2E2) Summary

Immunogen
USP34 (NP_055524, 3296 a.a. ~ 3396 a.a) partial recombinant protein with GST tag.CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDG QALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIEST IHVVTRISGKGNQAAS
Specificity
USP34 - ubiquitin specific protease 34
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP34
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00009736-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP34 Antibody (2E2)

  • Deubiquitinating enzyme 34
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ43910
  • KIAA0570MGC104459
  • KIAA0729ubiquitin carboxyl-terminal hydrolase 34
  • ubiquitin specific peptidase 34
  • ubiquitin specific protease 34
  • ubiquitin thioesterase 34
  • Ubiquitin thiolesterase 34
  • Ubiquitin-specific-processing protease 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
H00009736-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for USP34 Antibody (H00009736-M01)(2)

Reviews for USP34 Antibody (H00009736-M01) (0)

There are no reviews for USP34 Antibody (H00009736-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP34 Antibody (H00009736-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP34 Products

Bioinformatics Tool for USP34 Antibody (H00009736-M01)

Discover related pathways, diseases and genes to USP34 Antibody (H00009736-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP34 Antibody (H00009736-M01)

Discover more about diseases related to USP34 Antibody (H00009736-M01).
 

Pathways for USP34 Antibody (H00009736-M01)

View related products by pathway.

PTMs for USP34 Antibody (H00009736-M01)

Learn more about PTMs related to USP34 Antibody (H00009736-M01).

Blogs on USP34

There are no specific blogs for USP34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP34 Antibody (2E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP34
Entrez
Uniprot