Uridine Phosphorylase 1/UPP1 Antibody (2F5)

Images

 
Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Analysis of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
ELISA: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Detection limit for recombinant GST tagged UPP1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Uridine Phosphorylase 1/UPP1 Antibody (2F5) Summary

Immunogen
UPP1 (NP_003355, 1 a.a. - 92 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGT
Specificity
UPP1 - uridine phosphorylase 1 (2F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UPP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Uridine Phosphorylase 1/UPP1 Antibody (2F5)

  • EC 2.4.2.3
  • UDPRASE
  • UDRPASE
  • UP
  • UPASE 1
  • UPASE
  • UPP
  • UPP1
  • UPUPase 1
  • UrdPase 1
  • uridine phosphorylase 1
  • uridine phosphorylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46297
Species: Hu
Applications: WB, IHC
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB

Publications for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01) (0)

There are no publications for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01) (0)

There are no reviews for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uridine Phosphorylase 1/UPP1 Products

Bioinformatics Tool for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01)

Discover related pathways, diseases and genes to Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01)

Discover more about diseases related to Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01).
 

Pathways for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01)

View related products by pathway.

Blogs on Uridine Phosphorylase 1/UPP1

There are no specific blogs for Uridine Phosphorylase 1/UPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uridine Phosphorylase 1/UPP1 Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol UPP1
Entrez
Uniprot