UNC13A/Munc13-1 Antibody


Immunocytochemistry/ Immunofluorescence: Munc13-1 Antibody [NBP1-87895] - Staining of human cell line U-2 OS shows positivity in nucleoli.
Immunohistochemistry-Paraffin: UNC13A/Munc13-1 Antibody [NBP1-87895] - Staining of human nasopharynx shows distinct membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Munc13-1 Antibody [NBP1-87895] - Staining of human nasopharynx shows distinct membranous positivity in respiratory epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

UNC13A/Munc13-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QLSEDFDPDEHSLQGSDMEDERDRDSYHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEE
Specificity of human UNC13A/Munc13-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UNC13A/Munc13-1 Protein (NBP1-87895PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UNC13A/Munc13-1 Antibody

  • KIAA1032Munc13-1protein unc-13 homolog A
  • Munc13-1
  • unc-13 homolog A (C. elegans)
  • UNC13A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, IA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UNC13A/Munc13-1 Antibody (NBP1-87895) (0)

There are no publications for UNC13A/Munc13-1 Antibody (NBP1-87895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC13A/Munc13-1 Antibody (NBP1-87895) (0)

There are no reviews for UNC13A/Munc13-1 Antibody (NBP1-87895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UNC13A/Munc13-1 Antibody (NBP1-87895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UNC13A/Munc13-1 Products

Bioinformatics Tool for UNC13A/Munc13-1 Antibody (NBP1-87895)

Discover related pathways, diseases and genes to UNC13A/Munc13-1 Antibody (NBP1-87895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC13A/Munc13-1 Antibody (NBP1-87895)

Discover more about diseases related to UNC13A/Munc13-1 Antibody (NBP1-87895).

Pathways for UNC13A/Munc13-1 Antibody (NBP1-87895)

View related products by pathway.

PTMs for UNC13A/Munc13-1 Antibody (NBP1-87895)

Learn more about PTMs related to UNC13A/Munc13-1 Antibody (NBP1-87895).

Blogs on UNC13A/Munc13-1

There are no specific blogs for UNC13A/Munc13-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UNC13A/Munc13-1 Antibody and receive a gift card or discount.


Gene Symbol UNC13A