UNC13A/Munc13-1 Antibody

Immunohistochemistry-Paraffin: UNC13A/Munc13-1 Antibody [NBP1-87895] - Staining of human nasopharynx shows distinct membranous positivity in respiratory epithelial cells.

Product Discontinued

UNC13A/Munc13-1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLSEDFDPDEHSLQGSDMEDERDRDSYHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC13A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UNC13A/Munc13-1 Antibody

• KIAA1032Munc13-1protein unc-13 homolog A
• Munc13-1
• unc-13 homolog A (C. elegans)
• UNC13A

Background

Munc13-1, a protein of the UNC13 family (UNC13A), are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase C (see PRKCA; MIM 176960). Rodent Munc13-1 is a presynaptic protein with an essential role in synaptic vesicle priming (Rossner et al., 2004 [PubMed 15123597]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC13A