UMPS Antibody (2F5)

Images

 
Western Blot: UMPS Antibody (2F5) [H00007372-M05] - Analysis of UMPS expression in transfected 293T cell line by UMPS monoclonal antibody (M05), clone 2F5. Lane 1: UMPS transfected lysatE (52.2 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: UMPS Antibody (2F5) [H00007372-M05] - Analysis of monoclonal antibody to UMPS on HeLa cell. Antibody concentration 10 ug/ml
ELISA: UMPS Antibody (2F5) [H00007372-M05] - Detection limit for recombinant GST tagged UMPS is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UMPS Antibody (2F5) Summary

Immunogen
UMPS (NP_000364, 381 a.a. - 479 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Specificity
UMPS (2F5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UMPS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007372-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UMPS Antibody (2F5)

  • EC 4.1.1.23
  • OMPdecase
  • OPRT
  • OPRTase
  • orotate phosphoribosyltransferase
  • orotidine 5'-phosphate decarboxylase
  • UMP synthase
  • uridine 5'-monophosphate synthase
  • uridine monophosphate synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
NBP1-86097
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007372-M05
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for UMPS Antibody (H00007372-M05)(1)

Reviews for UMPS Antibody (H00007372-M05) (0)

There are no reviews for UMPS Antibody (H00007372-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UMPS Antibody (H00007372-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UMPS Products

Bioinformatics Tool for UMPS Antibody (H00007372-M05)

Discover related pathways, diseases and genes to UMPS Antibody (H00007372-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UMPS Antibody (H00007372-M05)

Discover more about diseases related to UMPS Antibody (H00007372-M05).
 

Pathways for UMPS Antibody (H00007372-M05)

View related products by pathway.

PTMs for UMPS Antibody (H00007372-M05)

Learn more about PTMs related to UMPS Antibody (H00007372-M05).

Blogs on UMPS

There are no specific blogs for UMPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UMPS Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol UMPS
Entrez
OMIM
Uniprot