UGT2B15 Antibody

Images

 
Western Blot: UGT2B15 Antibody [NBP1-69700] - This Anti-UGT2B15 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT2B15 Antibody Summary

Immunogen
Synthetic peptides corresponding to UGT2B15(UDP glucuronosyltransferase 2 family, polypeptide B15) The peptide sequence was selected from the N terminal of UGT2B15. Peptide sequence IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT2B15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UGT2B15 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT2B15 Antibody

  • EC 2.4.1
  • EC 2.4.1.17
  • HLUG4
  • UDP glucuronosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B8
  • UDP-glucuronosyltransferase UGT2B15
  • UDP-glucuronyltransferase, family 2, beta-15
  • UDPGT 2B15
  • UDPGT 2B8
  • UDPGTH3
  • UDPGTh-3
  • UGT2B8UDPGT2B15

Background

The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1605 AF180322.1 1-1605 1606-1700 U06641.1 1547-1641 1701-1798 U08854.1 1684-1781 1799-1801 U06641.1 1779-1781 1802-1837 U06641.1 1783-1818 1838-1909 U08854.1 1822-1893 1910-2106 AF180322.1 1911-2107 2107-2144 U06641.1 2086-2123

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-69412
Species: Hu
Applications: WB
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
NBP2-06724
Species: Hu
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-08443
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69700
Species: Hu
Applications: WB

Publications for UGT2B15 Antibody (NBP1-69700) (0)

There are no publications for UGT2B15 Antibody (NBP1-69700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B15 Antibody (NBP1-69700) (0)

There are no reviews for UGT2B15 Antibody (NBP1-69700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B15 Antibody (NBP1-69700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT2B15 Products

Bioinformatics Tool for UGT2B15 Antibody (NBP1-69700)

Discover related pathways, diseases and genes to UGT2B15 Antibody (NBP1-69700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B15 Antibody (NBP1-69700)

Discover more about diseases related to UGT2B15 Antibody (NBP1-69700).
 

Pathways for UGT2B15 Antibody (NBP1-69700)

View related products by pathway.

PTMs for UGT2B15 Antibody (NBP1-69700)

Learn more about PTMs related to UGT2B15 Antibody (NBP1-69700).

Blogs on UGT2B15

There are no specific blogs for UGT2B15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT2B15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B15
Uniprot