UGT2B10 Antibody (1B5)

Images

 
There are currently no images for UGT2B10 Antibody (H00007365-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGT2B10 Antibody (1B5) Summary

Immunogen
UGT2B10 (NP_001066 62 a.a. - 159 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGT2B10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGT2B10 Antibody (1B5)

  • EC 2.4.1.17
  • MGC142209
  • UDP glucuronosyltransferase 2 family, polypeptide B10
  • UDP glucuronosyltransferase 2B10
  • UDP glycosyltransferase 2 family, polypeptide B10
  • UDP-glucuronosyltransferase 2B10
  • UDPGT 2B10
  • UDPGT2B10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP1-69412
Species: Hu
Applications: WB
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
H00007366-B01P
Species: Hu
Applications: WB
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP2-06724
Species: Hu
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00007365-M02
Species: Hu
Applications: WB, ELISA

Publications for UGT2B10 Antibody (H00007365-M02) (0)

There are no publications for UGT2B10 Antibody (H00007365-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B10 Antibody (H00007365-M02) (0)

There are no reviews for UGT2B10 Antibody (H00007365-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B10 Antibody (H00007365-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT2B10 Products

Bioinformatics Tool for UGT2B10 Antibody (H00007365-M02)

Discover related pathways, diseases and genes to UGT2B10 Antibody (H00007365-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B10 Antibody (H00007365-M02)

Discover more about diseases related to UGT2B10 Antibody (H00007365-M02).
 

Pathways for UGT2B10 Antibody (H00007365-M02)

View related products by pathway.

PTMs for UGT2B10 Antibody (H00007365-M02)

Learn more about PTMs related to UGT2B10 Antibody (H00007365-M02).

Blogs on UGT2B10

There are no specific blogs for UGT2B10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT2B10 Antibody (1B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B10
Uniprot