UGCGL2 Antibody

Images

 
Immunohistochemistry-Paraffin: UGCGL2 Antibody [NBP2-13503] Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGCGL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNLGEKIKGIVENMGINA NNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQENDMFFNV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGGT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UGCGL2 Protein (NBP2-13503PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UGCGL2 Antibody

  • FLJ10873
  • HUGT2
  • MGC117360
  • UDP-Glc:glycoprotein glucosyltransferase 2
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP2-06724
Species: Hu
NBP1-69412
Species: Hu
Applications: WB
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00007366-B01P
Species: Hu
Applications: WB
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-08443
Species: Hu
NBP1-84494
Species: Hu
Applications: IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-86458
Species: Hu
Applications: IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UGCGL2 Antibody (NBP2-13503) (0)

There are no publications for UGCGL2 Antibody (NBP2-13503).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCGL2 Antibody (NBP2-13503) (0)

There are no reviews for UGCGL2 Antibody (NBP2-13503). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UGCGL2 Antibody (NBP2-13503) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGCGL2 Products

Bioinformatics Tool for UGCGL2 Antibody (NBP2-13503)

Discover related pathways, diseases and genes to UGCGL2 Antibody (NBP2-13503). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UGCGL2

There are no specific blogs for UGCGL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGCGL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGGT2