Recombinant Human UCP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UCP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-325 of Human SLC25A14 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI

Protein/Peptide Type
Recombinant Protein
Gene
SLC25A14

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UCP5 Protein

  • BMCP-1
  • BMCP1UCP 5
  • brain mitochondrial carrier protein 1
  • Mitochondrial uncoupling protein 5
  • solute carrier family 25 (mitochondrial carrier, brain), member 14
  • Solute carrier family 25 member 14
  • UCP5MGC149543

Background

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is widely expressed in many tissues with the greatest abundance in brain and testis. The gene product has an N-terminal hydrophobic domain that is not present in other UCPs. Two splice variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-57763
Species: Hu
Applications: ICC/IF
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00009016-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for UCP5 Recombinant Protein (H00009016-P01) (0)

There are no publications for UCP5 Recombinant Protein (H00009016-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP5 Recombinant Protein (H00009016-P01) (0)

There are no reviews for UCP5 Recombinant Protein (H00009016-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP5 Recombinant Protein (H00009016-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCP5 Products

Bioinformatics Tool for UCP5 Recombinant Protein (H00009016-P01)

Discover related pathways, diseases and genes to UCP5 Recombinant Protein (H00009016-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP5 Recombinant Protein (H00009016-P01)

Discover more about diseases related to UCP5 Recombinant Protein (H00009016-P01).
 

Pathways for UCP5 Recombinant Protein (H00009016-P01)

View related products by pathway.

PTMs for UCP5 Recombinant Protein (H00009016-P01)

Learn more about PTMs related to UCP5 Recombinant Protein (H00009016-P01).

Blogs on UCP5

There are no specific blogs for UCP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UCP5 Antibody
NBP2-56930

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UCP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A14