UCP5 Antibody (1C12)

Images

 
There are currently no images for UCP5 Antibody (H00009016-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UCP5 Antibody (1C12) Summary

Immunogen
SLC25A14 (NP_003942.1, 1 a.a. - 325 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC25A14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UCP5 Antibody (1C12)

  • BMCP-1
  • BMCP1UCP 5
  • brain mitochondrial carrier protein 1
  • Mitochondrial uncoupling protein 5
  • solute carrier family 25 (mitochondrial carrier, brain), member 14
  • Solute carrier family 25 member 14
  • UCP5MGC149543

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-57763
Species: Hu
Applications: ICC/IF
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00009016-M01
Species: Hu
Applications: ELISA

Publications for UCP5 Antibody (H00009016-M01) (0)

There are no publications for UCP5 Antibody (H00009016-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP5 Antibody (H00009016-M01) (0)

There are no reviews for UCP5 Antibody (H00009016-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UCP5 Antibody (H00009016-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UCP5 Products

Bioinformatics Tool for UCP5 Antibody (H00009016-M01)

Discover related pathways, diseases and genes to UCP5 Antibody (H00009016-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP5 Antibody (H00009016-M01)

Discover more about diseases related to UCP5 Antibody (H00009016-M01).
 

Pathways for UCP5 Antibody (H00009016-M01)

View related products by pathway.

PTMs for UCP5 Antibody (H00009016-M01)

Learn more about PTMs related to UCP5 Antibody (H00009016-M01).

Blogs on UCP5

There are no specific blogs for UCP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP5 Antibody (1C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A14
Uniprot