UBR5/EDD Recombinant Protein Antigen

Images

 
There are currently no images for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBR5/EDD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBR5/EDD.

Source: E. coli

Amino Acid Sequence: GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBR5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58579.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBR5/EDD Recombinant Protein Antigen

  • DD5
  • E3 ubiquitin protein ligase, HECT domain containing, 1
  • E3 ubiquitin-protein ligase, HECT domain-containing 1
  • EC 6.3.2
  • EC 6.3.2.-
  • EDD
  • EDD1
  • EDD1E3 ubiquitin-protein ligase UBR5
  • EDDE3 identified by differential display
  • hHYD
  • HYD
  • HYDFLJ11310
  • Hyperplastic discs protein homolog
  • KIAA0896MGC57263
  • progestin induced protein
  • Progestin-induced protein
  • ubiquitin protein ligase E3 component n-recognin 5
  • ubiquitin-protein ligase
  • UBR5

Background

EDD encodes a progestin-induced protein, which belongs to the HECT (homology to E6-AP carboxyl terminus) family. The HECT family proteins function as E3 ubiquitin-protein ligases, targeting specific proteins for ubiquitin-mediated proteolysis. This gene is localized to chromosome 8q22 which is disrupted in a variety of cancers. This gene potentially has a role in regulation of cell proliferation or differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP2-16374
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB6218
Species: Hu, Mu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
E2-622
Species: Hu
Applications: EnzAct
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB

Publications for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP) (0)

There are no publications for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP) (0)

There are no reviews for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBR5/EDD Products

Research Areas for UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP)

Find related products by research area.

Blogs on UBR5/EDD

There are no specific blogs for UBR5/EDD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBR5/EDD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR5