UBE2W Antibody (7G4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: UBE2W Antibody (7G4) [H00055284-M01] - Analysis of monoclonal antibody to UBE2W on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: UBE2W Antibody (7G4) [H00055284-M01] - Detection limit for recombinant GST tagged UBE2W is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 7G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBE2W Antibody (7G4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse UBE2W Antibody (7G4) - Azide and BSA Free (H00055284-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: UBE2W (NP_001001481, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSP
• Specificity: UBE2W - ubiquitin-conjugating enzyme E2W (putative)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBE2W
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2W Antibody (7G4) - Azide and BSA Free

• EC 6.3.2.19
• FLJ11011
• hUBC-16
• probable ubiquitin-conjugating enzyme E2 W
• Ubc16
• UBE2W
• Ubiquitin carrier protein W
• ubiquitin-conjugating enzyme 16
• ubiquitin-conjugating enzyme E2W (putative)
• Ubiquitin-protein ligase W

Background

UBE2W catalyzes the covalent attachment of ubiquitin to other proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2W
• Entrez:
  • 55284(Human)
• Uniprot:
  • NP_001001481(Human)