UBE2Q1 Antibody

Images

 
Western Blot: UBE2Q1 Antibody [NBP2-83731] - WB Suggested Anti-UBE2Q1 Antibody. Titration: 1.0 ug/ml. Positive Control: HCT15 Whole CellUBE2Q1 is supported by BioGPS gene expression data to be expressed in HCT15

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2Q1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human UBE2Q1. Peptide sequence: EDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2Q1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2Q1 Antibody

  • EC 6.3.2.19
  • galactosyl transferase-associated protein
  • GTAP
  • NICE5
  • NICE-5
  • PRO3094
  • Protein NICE-5
  • UBE2Q
  • UBE2Q1
  • Ubiquitin carrier protein Q1
  • ubiquitin-conjugating enzyme E2 Q1
  • ubiquitin-conjugating enzyme E2Q (putative) 1
  • ubiquitin-conjugating enzyme E2Q (putative)
  • ubiquitin-conjugating enzyme E2Q family member 1
  • Ubiquitin-protein ligase Q1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31647
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00007170-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP3-09472
Species: Hu
Applications: WB
NB100-750
Species: Hu
Applications: IP, KD, WB
NBP2-97389
Species: Hu
Applications: ELISA, IF, IHC-P, WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00092912-M04
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-02965
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-80448
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34035
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82785
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14335
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for UBE2Q1 Antibody (NBP2-83731) (0)

There are no publications for UBE2Q1 Antibody (NBP2-83731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2Q1 Antibody (NBP2-83731) (0)

There are no reviews for UBE2Q1 Antibody (NBP2-83731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2Q1 Antibody (NBP2-83731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2Q1 Products

Bioinformatics Tool for UBE2Q1 Antibody (NBP2-83731)

Discover related pathways, diseases and genes to UBE2Q1 Antibody (NBP2-83731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2Q1 Antibody (NBP2-83731)

Discover more about diseases related to UBE2Q1 Antibody (NBP2-83731).
 

Pathways for UBE2Q1 Antibody (NBP2-83731)

View related products by pathway.

PTMs for UBE2Q1 Antibody (NBP2-83731)

Learn more about PTMs related to UBE2Q1 Antibody (NBP2-83731).

Blogs on UBE2Q1

There are no specific blogs for UBE2Q1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2Q1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2Q1