UbcH8/Ube2L6 Antibody (2F12-1F4)

Images

 
Western Blot: UbcH8/Ube2L6 Antibody (2F12-1F4) [H00009246-M01] - Analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody (M01), clone 2F12-1F4.Lane 1: UBE2L6 transfected lysate(17.595 ...read more
Western Blot: UbcH8/Ube2L6 Antibody (2F12-1F4) [H00009246-M01] - analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody (M01), clone 2F12-1F4.
Sandwich ELISA: UbcH8/Ube2L6 Antibody (2F12-1F4) [H00009246-M01] - Detection limit for recombinant GST tagged UBE2L6 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F12-1F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UbcH8/Ube2L6 Antibody (2F12-1F4) Summary

Immunogen
UBE2L6 (AAH32491, 1 a.a. ~ 154 a.a) full length recombinant protein with GST tag.MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPD QPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQ ICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLA DLLTQNPELFRKNAEEFTLRFGVDRPS
Specificity
UBE2L6 - ubiquitin-conjugating enzyme E2L 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2L6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00009246-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UbcH8/Ube2L6 Antibody (2F12-1F4)

  • EC 6.3.2.19
  • retinoic acid induced gene B protein
  • Retinoic acid-induced gene B protein
  • RIG-B
  • UbcH8
  • UBCH8MGC40331
  • UBE2L6
  • Ubiquitin carrier protein L6
  • ubiquitin/ISG15-conjugating enzyme E2 L6
  • ubiquitin-conjugating enzyme E2L 6
  • Ubiquitin-protein ligase L6

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
A-306
Species: Hu
Applications: WB, IHC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP1-87989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
E2-616
Species: Hu
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009246-M01
Species: Hu
Applications: WB, ELISA

Publications for UbcH8/Ube2L6 Antibody (H00009246-M01)(1)

Reviews for UbcH8/Ube2L6 Antibody (H00009246-M01) (0)

There are no reviews for UbcH8/Ube2L6 Antibody (H00009246-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UbcH8/Ube2L6 Antibody (H00009246-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UbcH8/Ube2L6 Products

Bioinformatics Tool for UbcH8/Ube2L6 Antibody (H00009246-M01)

Discover related pathways, diseases and genes to UbcH8/Ube2L6 Antibody (H00009246-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH8/Ube2L6 Antibody (H00009246-M01)

Discover more about diseases related to UbcH8/Ube2L6 Antibody (H00009246-M01).
 

Pathways for UbcH8/Ube2L6 Antibody (H00009246-M01)

View related products by pathway.

PTMs for UbcH8/Ube2L6 Antibody (H00009246-M01)

Learn more about PTMs related to UbcH8/Ube2L6 Antibody (H00009246-M01).
 

Research Areas for UbcH8/Ube2L6 Antibody (H00009246-M01)

Find related products by research area.

Blogs on UbcH8/Ube2L6

There are no specific blogs for UbcH8/Ube2L6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH8/Ube2L6 Antibody (2F12-1F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2L6
Entrez
OMIM
Uniprot