We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UAP56 Recombinant Protein Antigen

Images

 
There are currently no images for UAP56 Recombinant Protein Antigen (NBP2-46824PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UAP56 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UAP56

Source: E. coli

Amino Acid Sequence: YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX39B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46824.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UAP56 Recombinant Protein Antigen

  • 56 kDa U2AF65-associated protein
  • ATP-dependent RNA helicase p47
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
  • DEAD box protein UAP56
  • EC 3.6.4.13
  • HLA-B associated transcript 1
  • HLA-B-associated transcript 1 protein
  • spliceosome RNA helicase BAT1
  • UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)

Background

UAP56 encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48848
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-16134
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17582
Species: Mu
Applications: CyTOF-ready, Flow
NBP1-70344
Species: Am, Bv, Ca, Pm, Eq, Hu, Pm
Applications: WB
211-TBB/CF
Species: Hu
Applications: BA
NBP2-33471
Species: Hu
Applications: IHC,  IHC-P
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13381
Species: Hu
Applications: Simple Western, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45072
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00000534-M02
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88376
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for UAP56 Recombinant Protein Antigen (NBP2-46824PEP) (0)

There are no publications for UAP56 Recombinant Protein Antigen (NBP2-46824PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UAP56 Recombinant Protein Antigen (NBP2-46824PEP) (0)

There are no reviews for UAP56 Recombinant Protein Antigen (NBP2-46824PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UAP56 Recombinant Protein Antigen (NBP2-46824PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UAP56 Products

Blogs on UAP56

There are no specific blogs for UAP56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UAP56 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX39B