U2AF1L4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: U2AF1L4 Antibody [NBP2-55898] - Staining of human cell line A549 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

U2AF1L4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: U2AF1L4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  U2AF1L4 Recombinant Protein Antigen (NBP2-55898PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for U2AF1L4 Antibody - BSA Free

• FLJ35525
• MGC33901
• splicing factor U2AF 26 kDa subunit
• U2 auxiliary factor 26
• U2 small nuclear RNA auxiliary factor 1-like 3
• U2 small nuclear RNA auxiliary factor 1-like 4
• U2 small nuclear RNA auxiliary factor 1-like protein 3
• U2 small nuclear RNA auxiliary factor 1-like protein 4
• U2(RNU2) small nuclear RNA auxiliary factor 1-like 3
• U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3
• U2AF1L3
• U2AF1L3V1
• U2AF1-like protein 3
• U2AF1RS3
• U2AF1-RS3
• U2af26

Background

RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutiveand enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required foraccurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participatesin the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T cell activation; anevent reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: U2AF1L4